Ms Recom EGF, 50 µg

From STEMCELL Technologies, this recombinant growth factor is the founding member of the EGF family of proteins, characterized by high-affinity binding to EGF receptors (EGFRs) and the production of mitogenic responses. It promotes EGFR dimerization, resulting in activation of downstream pathways including PI3K, ERK1/2, JAK/STAT, β-catenin, and calcium signaling.

Secreted by gut-associated salivary and Brunner's glands, the protein is found in a variety of body fluids and stimulates cell proliferation and differentiation in rodent and neonatal human intestine. It can be used to stimulate the proliferation of mouse embryonic stem cells or induce the terminal differentiation and growth inhibition of A431 cells.

Produced in E. coli with a purity of ≥ 95%, the lyophilized product is formulated by dialysis against phosphate-buffered saline. The predicted molecular mass is 6.2 kDa and the amino acid sequence is MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR, with accession number P01132. It shows cross-reactivity with human and rat species. Specific activity is ≥ 1 x 10^7 units/mg, with an EC50 ≤ 0.1 ng/mL as determined by a cell proliferation assay using BALB/c 3T3 cells. Endotoxin level is ≤ 0.2 EU/μg protein, measured by kinetic Limulus amebocyte lysate (LAL) analysis. Per the safety data sheet, this laboratory reagent is not classified as a hazardous substance or mixture according to the Globally Harmonized System (GHS). Alternative names include Beta-urogastrone, HOMG4, URG, and Urogastrone.