CoV-2 NS8 Pep Pool 25ug/pep

This lyophilized research reagent from STEMCELL Technologies is a mixture of 28 peptides derived from the non-structural protein 8 (NS8) of SARS-CoV-2, designed for immune cell activation. The pool consists of 15-mer peptides with 11-amino-acid overlaps that cover amino acids 1–121 on NS8. The product is formulated at approximately 25 μg (15 nmol) per peptide, which is sufficient for stimulating 2.5 x 10^8 cells. Peptides are lyophilized as trifluoroacetate salts with an average purity of 70%.

Provided lyophilized, the product should be warmed to room temperature (15–25°C) before reconstitution. Add pure dimethyl sulfoxide (DMSO; ~40 μL) and dilute with water to the desired concentration, ensuring the final DMSO concentration is below 1% (v/v) to avoid toxicity in the biological system. Store at -20°C; stable as supplied until the expiry date on the label. Protect from light and avoid repeated freeze-thaw cycles.

For research use only; not intended for human or animal diagnostic or therapeutic uses. The associated protein ID is P0DTC8, with gene name NS8. The amino acid sequence of the covered region is: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI.