Anti-ZSCAN4C Antibody

Manufactured by Antibodies.com, this rabbit polyclonal IgG antibody is raised against ZSCAN4C and is unconjugated. It is validated for Western blot applications and reacts with mouse samples. The antibody is supplied as a liquid in Phosphate Buffered Saline (pH 7.3) containing 50% glycerol and 0.02% sodium azide.

The immunogen is a synthetic peptide corresponding to amino acids 400-506 of mouse ZSCAN4 (NP_001013787.1), with the immunogen sequence CSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIHMPEKPFKCSTCEKSFSHKTNLKSHEMIHTGEMPYVCSLCSRRFRQSSTYHRHLRNYHRSD. The reported molecular weight is 57 kDa, and the antibody is purified by affinity chromatography.

For Western blot, a working dilution range of 1:500-1:2,000 is recommended. The product is shipped at 4°C; upon receipt, it should be aliquoted and stored at -20°C, with freeze/thaw cycles avoided.