Anti-UCP1 Antibody

This Antibodies.com primary antibody is a rabbit polyclonal reagent raised against UCP1. It is supplied as an unconjugated liquid in phosphate-buffered saline (pH 7.3) containing 50% glycerol and 0.05% Proclin 300, and the IgG isotype has been affinity-purified.

Manufacturer data validate the reagent for Western blot (WB), immunohistochemistry (IHC) and immunocytochemistry/immunofluorescence (ICC/IF), with recommended dilutions of 1:100-1:500 for WB, 1:50-1:200 for IHC and 1:50-1:200 for ICC/IF. Four scientific validation images are provided. The Antibodies.com listing reports reactivity with Human, Mouse and Rat samples, while the manufacturer datasheet specifies validated reactivity with Mouse and Rat. The reported target molecular weight is 30 kDa and concentration is lot-specific.

The immunogen is a synthetic peptide corresponding to amino acids 100-200 of human UCP1 (NP_068605.1), with sequence QEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKE. The antibody is shipped at 4°C; on arrival it should be aliquoted and stored at -20°C, avoiding freeze/thaw cycles.