Anti-SLC4A4 Antibody - Identical to Abcam (ab187511)

Rabbit polyclonal antibody targeting SLC4A4/NBC, supplied by Antibodies.com as a primary antibody reagent. The antibody is raised in Rabbit, is of the IgG isotype, and is unconjugated. It reacts with Human, Mouse and Rat samples.

Per the manufacturer datasheet, the reagent is validated for Western blot (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications, with recommended dilutions of 1:500–1:1,000 for WB and 1:50–1:200 for ICC/IF. The catalogue listing additionally notes IHC among the reported applications. The target has a reported molecular weight of 135 kDa. The immunogen is a synthetic peptide corresponding to amino acids 980–1079 of human SLC4A4/NBC, with sequence ILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC. The reagent is purified by affinity purification.

Supplied as a liquid in Phosphate Buffered Saline (pH 7.3) containing 50% glycerol and 0.01% thiomersal. It is shipped at 4°C; upon delivery, the antibody should be aliquoted and stored at -20°C, with freeze/thaw cycles avoided.