Anti-SCN2A Antibody

From Antibodies.com, this rabbit polyclonal primary antibody targets SCN2A and is supplied as an unconjugated liquid with an IgG isotype. It is validated for Western blot (WB) at a recommended dilution of 1:1,000–1:2,000 and reacts with human samples. The immunogen is a recombinant fusion protein corresponding to amino acids 275–401 of human SCN2A (NP_001035232.1), with the sequence RNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTY.

Purified by affinity chromatography, the antibody corresponds to a 250 kDa target. It is provided in Phosphate Buffered Saline (pH 7.3) containing 50% glycerol and 0.01% thiomersal. The product is shipped at 4 °C and should be aliquoted upon delivery and stored at –20 °C, with freeze/thaw cycles avoided.