Anti-RFWD2 Antibody

Rabbit polyclonal antibody targeting RFWD2, also referred to as COP1, offered by Antibodies.com as a primary antibody reagent. The unconjugated IgG antibody is raised in rabbit and validated for use in Western blot (WB) and immunohistochemistry (IHC) applications.

Reactivity has been demonstrated against Human, Mouse and Rat samples. The immunogen is a recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human RFWD2 (NP_071902.2), with the reported immunogen sequence YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV. The stated molecular weight for the target protein is 110 kDa.

The product is supplied as a liquid in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide, and has been purified by affinity chromatography. It is shipped at 4°C; upon delivery it should be aliquoted and stored at -20°C, avoiding freeze/thaw cycles. Recommended dilutions are WB: 1:500-1:2,000 and IHC: 1:100-1:200. One scientific validation image is available.