Anti-PRKCA Antibody [Assigned #A11107]

Available from Antibodies.com as a primary antibody, this rabbit monoclonal [ARC0197] reagent targets PKC alpha (PRKCA) and is validated by the manufacturer for Western blotting, immunohistochemistry and immunoprecipitation in human, mouse and rat samples. The unconjugated IgG antibody is supplied as a liquid and purified by affinity chromatography. The product is supported by 3 scientific images.

The immunogen is a synthetic peptide spanning amino acids 573–672 of human PKC alpha (UniProt P17252); the peptide sequence is MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV. The target protein has a reported molecular weight of 76 kDa. The antibody is formulated in Phosphate Buffered Saline (pH 7.3) containing 50% glycerol, 0.05% BSA and 0.02% sodium azide, and is shipped at 4 °C. Upon delivery it should be aliquoted and stored at −20 °C, with freeze/thaw cycles to be avoided. Manufacturer-recommended dilutions are WB 1:500–1:2,000, IHC 1:50–1:200 and IP 1:500–1:1,000.