Anti-PMS2 Antibody

Antibodies.com supplies a Rabbit polyclonal antibody raised against PMS2, provided as an unconjugated IgG reagent. One manufacturer formulation is validated for Western blot on human and rat samples, using an immunogen consisting of a synthetic peptide corresponding to amino acids 1-100 of human PMS2 (NP_000526.2), with the reported peptide sequence beginning MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQ. The target migrates at 110 kDa, and the antibody is affinity purified in phosphate buffered saline (pH 7.3) with 50% glycerol and 0.01% thiomersal; the recommended Western blot dilution range is 1:1,000-1:5,000.

A second manufacturer formulation is validated for Western blot and ELISA on human, mouse and rat samples, raised against a synthetic peptide within amino acid region 220-270 of human PMS2, supplied as a liquid at 0.65-0.69 µg/µL in a proprietary buffer (pH 7.4-7.8) containing 30% glycerol and 0.5% BSA, with recommended dilutions of 1:500-1:1,000 for Western blot and 1:20,000-1:50,000 for ELISA and dot blot. Both products are shipped at 4°C and stored at -20°C after aliquoting, avoiding freeze/thaw cycles.