Anti-PCDHA13 Antibody

From Antibodies.com, this Primary Antibody is an unconjugated rabbit polyclonal reagent that targets PCDHA13. The product is validated for Western Blot (WB) applications and is reported as reactive with Human, Mouse and Rat samples. PCDHA13 is a protocadherin alpha family member mapped to chromosome 5 (140882124 - 141012347), with group-enriched tissue expression reported in brain, parathyroid gland and retina.

The immunogen is a recombinant fusion protein corresponding to amino acids 300-360 of human PCDHA13 (NP_061727.1), with the peptide sequence GEIRTKGKLDFEEKKLYEISVEAVDKGNIPMAGHCTLLVEVLDVNDNAPEVTITSLSLPIR. The target has a reported molecular weight of 90 kDa. The antibody is affinity purified and supplied as a liquid in Phosphate Buffered Saline (pH 7.3) containing 50% Glycerol and 0.02% Sodium Azide; concentration is lot specific. The recommended Western Blot working dilution is 1:500-1:2,000. The product ships at 4°C and should be aliquoted on delivery and stored at -20°C, avoiding freeze/thaw cycles. One scientific validation image is referenced.