Anti-KDM4B Antibody

A polyclonal antibody from Antibodies.com targets KDM4B, also known as JMJD2B. Raised in rabbit, it is of the IgG isotype and supplied unconjugated. The Antibodies.com listing describes reactivity with Human, Mouse and Rat samples, while the manufacturer confirms Human and Mouse reactivity.

The manufacturer lists the antibody as validated for Western blot with a recommended dilution of 1:500-1:1,000. The Antibodies.com source additionally lists immunohistochemistry (IHC) and immunofluorescence (IF) as applications. The immunogen is a recombinant fusion protein containing a sequence corresponding to amino acids 917-1031 of human KDM4B/JMJD2B (NP_055830.1): RAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTLEEELP, and the target protein has a molecular weight of 150 kDa.

Provided as a liquid in Phosphate Buffered Saline (pH 7.3) with 50% Glycerol and 0.01% Thiomersal, the antibody has been affinity purified. Concentration is Lot Specific. It is shipped at 4°C and should be aliquoted and stored at -20°C upon delivery, avoiding freeze/thaw cycles.