Anti-KCNH2 Antibody

A rabbit polyclonal, unconjugated primary antibody targeting KCNH2 (also referred to as H-ERG), supplied by Antibodies.com. The antibody is of the IgG isotype and is validated for Western Blot (WB) per the Antibodies.com catalogue entry, with the manufacturer datasheet additionally listing Immunohistochemistry (IHC). Reactivity is reported against Human, Mouse, and Rat samples in the Antibodies.com listing, while the manufacturer datasheet reports reactivity against Human and Mouse samples.

The immunogen is a synthetic peptide corresponding to a sequence within amino acids 850-950 of human KCNH2 (NP_000229.1), with the immunogen sequence DHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSS. The target protein has a molecular weight of 148 kDa. The product is supplied as a liquid; concentration is lot specific. Formulation is Phosphate Buffered Saline at pH 7.3 with 50% glycerol and 0.01% Thiomersal. The antibody is purified by affinity purification. Four scientific validation images are referenced.

Recommended working dilutions from the manufacturer are WB: 1:500-1:2,000 and IHC: 1:50-1:200. Storage: shipped at 4°C; upon delivery, aliquot and store at -20°C, avoiding freeze/thaw cycles.