Anti-IPO11 Antibody

Antibodies.com offers a Rabbit polyclonal antibody to IPO11, validated for Western blotting (WB) and reactive with Human and Mouse samples. The unconjugated IgG antibody is raised in Rabbit and supplied as a liquid formulation in Phosphate Buffered Saline (pH 7.3) with 50% glycerol and 0.01% Thiomersal. It has a molecular weight of 112 kDa and is provided at a lot-specific concentration.

The immunogen is a recombinant fusion protein corresponding to amino acids 776-975 of human IPO11 (NP_057422.3), with the sequence KGIIEGERYPVVMSTYLGVMGRVLLQNTSFFSSLLNEMAHKFNQEMDQLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQDKRKKMLALKDPVHTVSLQQFIYEKLKAQQEMLGEQGFQSLMETVDTEIVTQLQEFLQGF. The antibody is purified by affinity purification and is accompanied by 1 scientific validation image. Recommended WB dilution is 1:500-1:2,000. The product is shipped at 4°C; upon delivery it should be aliquoted and stored at -20°C, avoiding freeze/thaw cycles.