Anti-IGF2 Antibody

From Antibodies.com, this rabbit polyclonal antibody targets IGF2 and is supplied as an unconjugated IgG in liquid form. The target protein has a molecular weight of 20 kDa, and the antibody is formulated in Phosphate Buffered Saline (pH 7.3) with 50% glycerol and 0.01% thiomersal. Purification is by affinity chromatography and the concentration is lot specific.

The antibody has been validated against human, mouse and rat samples. The immunogen is a recombinant fusion protein corresponding to amino acids 26-127 of human IGF2 (P01344), with the sequence YRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLR. Recommended dilutions are WB 1:500-1:1,000, IHC 1:50-1:200, and ICC/IF 1:50-1:200. The product ships at 4°C; on receipt, aliquot and store at -20°C, avoiding repeated freeze/thaw cycles. Three scientific validation images are included.