Anti-GRM8 Antibody - Identical to Abcam (ab176301)

This rabbit polyclonal antibody, supplied by Antibodies.com, is raised against GRM8 (metabotropic glutamate receptor 8), also referred to as MGLUR8. It is of the IgG isotype, unconjugated, and produced in rabbit.

The immunogen is a synthetic peptide corresponding to amino acids 1-100 of human GRM8 (NP_000836.2), with the sequence MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGV. The antibody has a reported molecular weight of 120 kDa and is supplied as a liquid in Phosphate Buffered Saline, pH 7.3, containing 50% glycerol and 0.02% sodium azide. It is purified by affinity purification, with concentration specified as lot specific. Storage instructions indicate shipment at 4°C, with aliquoting and storage at -20°C upon delivery and avoidance of freeze/thaw cycles.

Validated for Western blot application with a recommended dilution range of 1:500-1:2,000. Reported reactivity includes Human, Mouse, and Rat according to one listing, while the manufacturer's product page indicates reactivity with Human samples. The product is supported by 1 scientific validation image.