Anti-ERBB4 Antibody

This rabbit polyclonal IgG antibody, supplied unconjugated by Antibodies.com, targets ERBB4 (also known as ErbB4/HER4). The Antibodies.com listing indicates validated use in Western blot (WB) and immunohistochemistry (IHC), while the manufacturer's datasheet additionally lists immunocytochemistry/immunofluorescence (ICC/IF).

Antibodies.com reports reactivity with mouse and rat samples; the manufacturer extends reactivity to human samples as well. The immunogen is a synthetic peptide corresponding to amino acids 1150-1250 of human ErbB4/HER4 (NP_005226.1), with the specific peptide sequence YMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPR.

The antibody is affinity-purified and supplied as a liquid in Phosphate Buffered Saline (pH 7.3) with 50% glycerol and 0.01% thiomersal. Recommended dilutions are WB 1:500-1:1,000, IHC 1:50-1:200, and ICC/IF 1:50-1:200. The manufacturer's datasheet reports a target molecular weight of 180 kDa, indicates shipment at 4°C with storage at -20°C after aliquoting, and notes that the product is accompanied by 5 scientific images.