Anti-ERBB3 Antibody

This rabbit polyclonal antibody from Antibodies.com targets ErbB3/HER3 and is validated for Western blot (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications. The unconjugated IgG reagent reacts with Human, Mouse, and Rat samples and is reported to be KO validated.

It is supplied as a liquid in Phosphate Buffered Saline (pH 7.3) containing 50% glycerol and 0.05% Proclin 300, and is purified by affinity chromatography. The reported molecular weight of the target is 185 kDa. The immunogen is a recombinant fusion protein corresponding to amino acids 1275-1342 of human ErbB3/HER3 (NP_001973.2), with the sequence DYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT.

Recommended dilutions are WB: 1:500-1:1,000 and ICC/IF: 1:50-1:200. The product is shipped at 4°C; upon delivery it should be aliquoted and stored at -20°C, with freeze/thaw cycles avoided.