Anti-DPEP2 Antibody

From Antibodies.com, this Rabbit polyclonal antibody targets DPEP2 (Dipeptidase 2) and is supplied unconjugated as a liquid. It was raised against a recombinant fusion protein containing a sequence corresponding to amino acids 400–463 of human DPEP2 (NP_071750.1), with immunogen sequence VEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS.

The IgG antibody is affinity purified and formulated in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. Molecular Weight is 53 kDa and concentration is lot specific. The recommended working dilution for WB is 1:200–1:2,000. The reagent is shipped at 4°C; upon delivery it should be aliquoted and stored at -20°C, avoiding freeze/thaw cycles.

Validated for WB and unconjugated, the antibody reacts with Human, Mouse and Rat samples, and is supported by 1 scientific validation image.