Anti-DDC Antibody

From Antibodies.com, this unconjugated rabbit polyclonal IgG antibody targets DOPA Decarboxylase (DDC). It is validated for Western blot, immunohistochemistry, and immunocytochemistry/immunofluorescence applications and shows reactivity with human, mouse, and rat samples.

The antibody is purified by affinity chromatography and supplied as a liquid formulation in Phosphate Buffered Saline (pH 7.3) containing 50% glycerol and 0.05% Proclin 300. The reported molecular weight is 37 kDa / 54 kDa. The immunogen is a recombinant fusion protein corresponding to amino acids 1-137 of human DDC (NP_000781.2), with sequence MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKA.

Recommended working dilutions are 1:100-1:500 for Western blot, 1:50-1:200 for immunohistochemistry, and 1:50-1:200 for immunocytochemistry/immunofluorescence. The product is shipped at 4°C; upon receipt, aliquot and store at -20°C, avoiding repeated freeze/thaw cycles. For research use only.