Anti-CLDN1 Antibody

From Antibodies.com, this Rabbit polyclonal antibody targets CLDN1 (Claudin 1). It is unconjugated, of IgG isotype, and supplied as a liquid formulation in Phosphate Buffered Saline (pH 7.3) containing 50% glycerol and 0.05% ProClin 300. The antibody is affinity purified.

Validated applications listed by the manufacturer include WB and ELISA, with recommended dilutions of WB: 1:500-1:1,000 and ELISA: 1 µg/ml (starting concentration). The retailer listing also notes WB, IHC, and IF applications. Reactivity with Human samples is stated by the manufacturer, while the retailer listing additionally reports reactivity with Mouse and Rat. The immunogen is a synthetic peptide corresponding to amino acids 137-211 of human Claudin 1 (sequence: TAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV).

The reported molecular weight is 20 kDa with a predicted MW of 23 kDa. Concentration is lot specific. Storage instructions are shipped at 4°C, with aliquoting and storage at -20°C upon delivery, avoiding freeze/thaw cycles.