Anti-BRWD1 Antibody

Antibodies.com offers a rabbit polyclonal antibody targeting BRWD1 (also known as WDR9), raised against a recombinant fusion protein corresponding to amino acids 1-120 of human BRWD1 (NP_001007247.1). The immunogen sequence begins MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI.

The reagent is of the IgG isotype and is supplied unconjugated in liquid form. It is formulated in Phosphate Buffered Saline, pH 7.3, containing 50% Glycerol and 0.01% Thiomersal, and has been affinity purified. The reported molecular weight of the target protein is 263 kDa.

Validated for Western Blot (WB) applications, this polyclonal reagent reacts with Human and Mouse samples. The manufacturer recommends a WB dilution range of 1:1,000-1:3,000. The product is shipped at 4°C; upon delivery it should be aliquoted and stored at -20°C, with freeze/thaw cycles to be avoided. Concentration is reported as lot specific.