Anti-ATG2A Antibody

Offered by Antibodies.com, this Rabbit polyclonal antibody is raised against ATG2A and supplied unconjugated. It is validated for Western blot applications and reacts with human samples. The immunogen is a synthetic peptide corresponding to a sequence within amino acids 700–800 of human ATG2A (NP_055919.2), with sequence DLHGIYEDGGKPPVPCLRVSKALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSKRTMYETEEMVIPGDPEEMRT.

The antibody is of the IgG isotype, provided in liquid form and affinity purified. It is formulated in Phosphate Buffered Saline, pH 7.3, containing 50% glycerol and 0.02% sodium azide. The target protein has a molecular weight of 213 kDa. Recommended Western blot dilutions are 1:500 to 1:2,000. The product is shipped at 4°C; upon delivery it should be aliquoted and stored at −20°C, with freeze/thaw cycles avoided. This product is intended for research use only and is not intended for diagnostic or therapeutic use.