SNCA 61-140 Human

From Antibodies.com, this recombinant human alpha Synuclein fragment corresponds to the SNCA 61-140 target and is expressed in Escherichia coli. The product is supplied as a sterile filtered, colorless liquid at a concentration of 1 mg/ml, formulated in 20 mM Tris HCl buffer at pH 7.5 with 100 mM sodium chloride. Purity exceeds 95% as assessed by SDS-PAGE, and the predicted molecular weight is 8.4 kDa. The protein's partial sequence is MEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA, and it is validated for SDS-PAGE analysis.

For handling, the vial is shipped at 4°C and can be kept short term at 4°C for 2–4 weeks. Long-term storage at –20°C is recommended, with addition of a carrier protein such as 0.1% HSA or BSA to protect the protein, while repeated freeze/thaw cycles should be avoided.